PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019466m
Common NameEUTSA_v10019466mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 744aa    MW: 83069.4 Da    PI: 4.5984
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019466mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like28.33.9e-092292661755
          G2-like  17 aveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       ++ L G++   Pk+il +m+  +L l +v SHLQkY+ 
  Thhalv10019466m 229 TISIL-GAKDSCPKSILSIMNDSDLNLCQVGSHLQKYKA 266
                      67778.8999***************************85 PP

2Response_reg42.73e-15231281108
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH.ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                      vl++d + +  e l+++l++  y +v +  +++eal ++++++  +l++  iemp++d + +l+ +  ++  +p i+++ + + + + + l   
  Thhalv10019466m  23 VLLIDNDTTSIEFLTSMLKQFSY-KVMSLNKASEALSMIEKQKdTGLVIANIEMPHIDSHSFLTALLHKK--IPLILISPEINTKETSDLLTKS 113
                      89*********************.***************77666**********************6655..9********************* PP

                      ESEEEESS--HHHHH CS
     Response_reg  94 akdflsKpfdpeelv 108
                      a+ +l+Kp++++++ 
  Thhalv10019466m 114 ARFCLTKPISENDIE 128
                      **********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.71E-1620152IPR011006CheY-like superfamily
SMARTSM004484.2E-521131IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23003.8E-1921155No hitNo description
PROSITE profilePS5011026.74622135IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-1223128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.20E-1024134No hitNo description
Gene3DG3DSA:1.10.10.602.7E-8230269IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MTEKLTVNLA GNIVPERIGD ISVLLIDNDT TSIEFLTSML KQFSYKVMSL NKASEALSMI  60
EKQKDTGLVI ANIEMPHIDS HSFLTALLHK KIPLILISPE INTKETSDLL TKSARFCLTK  120
PISENDIENL WQHVVPKKSQ ELKKINIAEQ QEKVVEKNIL NQIESLRETI KRQRTSQSSL  180
LGRRPFVKTF TTPETYQKRK GKAIDEGKTK PVYPTEAENK REEGINMETI SILGAKDSCP  240
KSILSIMNDS DLNLCQVGSH LQKYKAQVKL MNHSLSRNEW RSTDKTFNYP SDYEYPFNAS  300
NLAKNIVENS FKKSAEKGKA KMVPKFHLGG KLDLSKHSLF GNLLNKSPME VNYAPSATSN  360
NPPSHIFSIH DVNHIILSSD NPPVLSGLLS SVGESNHSGL SDNPPVLSGL SSSVGASNHS  420
GLSSDNPPVL YGLSSSVGAS NTDAFQMESS GICIPQSEPN PFQPSSSVLE IDWNQLDLDF  480
IYIPEPYVPQ ADLCIMGESY FLPDLDFTMN TLETNMDQIS WSPSTDNIRD HETNINQIGC  540
MDWIPTLENY VLPQTDMNIN VPETNISSVE GYVASENMIP SEISNQMGMV SSGENHVLSQ  600
NVISHVGFAS GQTSYETSSQ TNTTTIFETN TDQIDWLHAS FETNKTQSLE TNMEDMALVP  660
YVEDNDVPIE ELIYFDIDVN EMDIDCWFEI LALLRKIFFF RRVSTSQKHN VMEPCGKQNM  720
EAGNPREAME GEDHFDDDPE CMS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391467.10.0hypothetical protein EUTSA_v10019466mg
SwissprotQ9C9F60.0APRR6_ARATH; Putative two-component response regulator-like APRR6
TrEMBLV4KN650.0V4KN65_EUTSA; Uncharacterized protein
STRINGAT1G68210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.10.0pseudo-response regulator 6